DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and CG12896

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster


Alignment Length:220 Identity:110/220 - (50%)
Similarity:147/220 - (66%) Gaps:9/220 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPI 70
            :.:|...|||.|:|::|.|.|::|..:||.:||||||||||||||||.|:|...|||.||..|.:
  Fly     1 MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65

  Fly    71 ALSCDTVESHKGWIEDIKSF-----GKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCR 130
            |.|.|.:.||..|:.||||:     |   .|.||||||..|:||:...|||:::.....:..|.|
  Fly    66 AHSVDALNSHVDWVNDIKSYCLDIPG---DFPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIR 127

  Fly   131 AVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLT-QTKSVATPADWKQGGKCMVLPTVKAE 194
            |:|::....|:|||:.||.:||||.|||||.||||||| :.|.|||||:|..|.|.|:||:|..:
  Fly   128 ALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSVTDD 192

  Fly   195 DVPKLFPDGIETIELPSGKSYLRIT 219
            :..||||.|.:.:.:|||.:|:|.|
  Fly   193 EAHKLFPKGFDKVSMPSGVNYVRTT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 110/218 (50%)
AhpC 8..198 CDD:223527 99/195 (51%)
CG12896NP_610584.2 AhpC 1..194 CDD:223527 99/195 (51%)
PRX_1cys 3..218 CDD:239314 110/218 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446106
Domainoid 1 1.000 126 1.000 Domainoid score I1772
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I1281
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101151at33392
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 1 1.000 - - otm3349
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - P PTHR43503
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2241
SonicParanoid 1 1.000 - - X1721
1211.830

Return to query results.
Submit another query.