DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and Prdx6b

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_796230.1 Gene:Prdx6b / 320769 MGIID:1336888 Length:224 Species:Mus musculus


Alignment Length:220 Identity:123/220 - (55%)
Similarity:157/220 - (71%) Gaps:3/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGVKPI 70
            |.:|::.|:|.|.|:.|||.|:|::.:||.:|||||.||||||||||.|.|.|.|||.||.||.|
Mouse     5 LLLGEEAPDFEANTTIGRIRFHDFLGNSWGMLFSHPKDFTPVCTTELGRAAKLAPEFAKRNVKLI 69

  Fly    71 ALSCDTVESHKGWIEDIKSFGKLS---SFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAV 132
            |||.|:||.|..|.:||.::...:   ...:|||.|..|::::.|.|||..|.:|..:|||.|.|
Mouse    70 ALSVDSVEDHLAWSKDINAYNGATPKEKLPFPIIDDKDRDISILFCMLDPVEKDANSMPLTARGV 134

  Fly   133 FVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAEDVP 197
            |:....|||::|:|||.:||||||||||||||||||:||.||||.|||:|...||||.:..|:..
Mouse   135 FIFGPDKKLKMSLLYPNSTGRNFDEILRVIDSLQLTETKPVATPVDWKKGESVMVLPDLPEEEAK 199

  Fly   198 KLFPDGIETIELPSGKSYLRITPQP 222
            :.||.||.|.:|||||:|||.||||
Mouse   200 RCFPKGISTTKLPSGKNYLRYTPQP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 118/214 (55%)
AhpC 8..198 CDD:223527 105/192 (55%)
Prdx6bNP_796230.1 AhpC 5..199 CDD:223527 106/193 (55%)
PRX_1cys 7..222 CDD:239314 118/214 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11609
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3147
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60653
OrthoDB 1 1.010 - - D1129256at2759
OrthoFinder 1 1.000 - - FOG0002615
OrthoInspector 1 1.000 - - otm43402
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR43503
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.