DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and tpx1

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_588430.1 Gene:tpx1 / 2539572 PomBaseID:SPCC576.03c Length:192 Species:Schizosaccharomyces pombe


Alignment Length:200 Identity:56/200 - (28%)
Similarity:94/200 - (47%) Gaps:16/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALNIGDQFPNF--TAETSEG--RIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKR 65
            :|.||...|:|  ||..:..  .|...|: :..|..|..:|.|||.||.||:...:....:|.:|
pombe     2 SLQIGKPAPDFKGTAVVNGAFEEIKLADY-KGKWVFLGFYPLDFTFVCPTEIVAFSEAASKFAER 65

  Fly    66 GVKPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCR 130
            ..:.|..|.|:..||..:|...:..|.|...:.|::||...:::..:.:|.:|    .|:..  |
pombe    66 NAQVILTSTDSEYSHLAFINTPRKEGGLGGINIPLLADPSHKVSRDYGVLIED----AGVAF--R 124

  Fly   131 AVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAED 195
            .:|::|.|..||...:.....||:.||.||::|:.|..:......||:|.:|.     .|:..::
pombe   125 GLFLIDPKGVLRQITINDLPVGRSVDEALRLLDAFQFVEEHGEVCPANWHKGS-----DTIDTKN 184

  Fly   196 VPKLF 200
            ..|.|
pombe   185 PEKYF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 54/196 (28%)
AhpC 8..198 CDD:223527 53/193 (27%)
tpx1NP_588430.1 AhpC 1..192 CDD:223527 55/199 (28%)
PRX_Typ2cys 5..176 CDD:239313 51/177 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.