DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx6005 and prdx-3

DIOPT Version :9

Sequence 1:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_497892.1 Gene:prdx-3 / 175573 WormBaseID:WBGene00011110 Length:226 Species:Caenorhabditis elegans


Alignment Length:190 Identity:57/190 - (30%)
Similarity:91/190 - (47%) Gaps:22/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GKALNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKRGV 67
            |.|:..|| |...:.:..:|:          |.::|.:|.|||.||.||:........||:..|.
 Worm    44 GTAVVDGD-FKVISDQDYKGK----------WLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGA 97

  Fly    68 KPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCRAV 132
            :.:|.|||:..||..|:...:..|.|...|.|::||..:::|..|.:|||:.      .|:.|.:
 Worm    98 EVVACSCDSHFSHLAWVNTPRKDGGLGDMDIPLLADFNKKIADSFGVLDKES------GLSYRGL 156

  Fly   133 FVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVK 192
            |::|....:|.:.......||:.||.|||:.:.|.:.......||||.:..     ||:|
 Worm   157 FLIDPSGTVRHTTCNDLPVGRSVDETLRVLKAFQFSDKHGEVCPADWHEDS-----PTIK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 55/185 (30%)
AhpC 8..198 CDD:223527 55/185 (30%)
prdx-3NP_497892.1 PRX_Typ2cys 37..206 CDD:239313 54/178 (30%)
AhpC 38..223 CDD:223527 57/190 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.