DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and ACBP6

DIOPT Version :10

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_174462.1 Gene:ACBP6 / 840069 AraportID:AT1G31812 Length:92 Species:Arabidopsis thaliana


Alignment Length:90 Identity:29/90 - (32%)
Similarity:46/90 - (51%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEERFQ---AAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQA 65
            ::|.|:   ..||.:..||.|       ..:|..|||:|||..|..|. .:||.:.:..:|||.|
plant     3 LKEEFEEHAEKVNTLTELPSN-------EDLLILYGLYKQAKFGPVDT-SRPGMFSMKERAKWDA 59

  Fly    66 WNDNRHLTKEEAMQRYVESLQEIIE 90
            |......:.||||..|:..:::::|
plant    60 WKAVEGKSSEEAMNDYITKVKQLLE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..83 CDD:459982 28/80 (35%)
ACBP6NP_174462.1 ACBP 3..87 CDD:238248 29/90 (32%)

Return to query results.
Submit another query.