DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and ACBP2

DIOPT Version :10

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_194507.1 Gene:ACBP2 / 828891 AraportID:AT4G27780 Length:354 Species:Arabidopsis thaliana


Alignment Length:90 Identity:30/90 - (33%)
Similarity:47/90 - (52%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEERFQAAVNVIKGLPKNGPYQ--PSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAW 66
            ::|.|.||...:.....:...|  || .:..:.|||:|.|||| |....:|....:..:||||||
plant   104 LDEAFSAATLFVTTAAADRLSQKVPS-DVQQQLYGLYKIATEG-PCTAPQPSALKMTARAKWQAW 166

  Fly    67 NDNRHLTKEEAMQRYVESLQEIIET 91
            .....:..||||::|:|.:.::..|
plant   167 QKLGAMPPEEAMEKYIEIVTQLYPT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..83 CDD:459982 28/79 (35%)
ACBP2NP_194507.1 ACBP 105..185 CDD:459982 29/81 (36%)
ANKYR <230..>338 CDD:440430
ANK repeat 236..263 CDD:293786
ANK repeat 265..296 CDD:293786
ANK repeat 298..329 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.