DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and ACBD4

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_016880573.1 Gene:ACBD4 / 79777 HGNCID:23337 Length:348 Species:Homo sapiens


Alignment Length:219 Identity:63/219 - (28%)
Similarity:100/219 - (45%) Gaps:61/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWNDN 69
            :::|||||:||:.|||||.|:||...||:||..:||||.| |.:..:|||||.:|:.||.|||..
Human    13 QKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMG-PCLVPRPGFWDPIGRYKWDAWNSL 76

  Fly    70 RHLTKEEAMQRYVESL----QEIIETMSFTENVQNFVGSLDSLGNISLD---------------E 115
            ..:::||||..|:..:    |::|:|:...|..::..|..:.|..:..|               :
Human    77 GKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWK 141

  Fly   116 LELVSPGMKELAE----------------------SHPNSPFHSRTNSPQH--------GSSC-- 148
            .::|:..:..::|                      :.|.||.|..|.:|:.        ..||  
Human   142 EQVVNGDVGAVSEPPCLPKEPAPPSPASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSCSL 206

  Fly   149 ---------NGEPEPEPQATSTAP 163
                     :|:...|.....|||
Human   207 THLSRFGQSSGQHLEESVIPGTAP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 42/88 (48%)
DUF1664 <217..272 CDD:285172
ACBD4XP_016880573.1 ACBP 13..93 CDD:376410 41/80 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155547
Domainoid 1 1.000 102 1.000 Domainoid score I6845
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546859at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40853
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.