Sequence 1: | NP_608729.1 | Gene: | CG8814 / 33492 | FlyBaseID: | FBgn0031478 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016880573.1 | Gene: | ACBD4 / 79777 | HGNCID: | 23337 | Length: | 348 | Species: | Homo sapiens |
Alignment Length: | 219 | Identity: | 63/219 - (28%) |
---|---|---|---|
Similarity: | 100/219 - (45%) | Gaps: | 61/219 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 EERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWNDN 69
Fly 70 RHLTKEEAMQRYVESL----QEIIETMSFTENVQNFVGSLDSLGNISLD---------------E 115
Fly 116 LELVSPGMKELAE----------------------SHPNSPFHSRTNSPQH--------GSSC-- 148
Fly 149 ---------NGEPEPEPQATSTAP 163 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8814 | NP_608729.1 | ACBP | 5..90 | CDD:279259 | 42/88 (48%) |
DUF1664 | <217..272 | CDD:285172 | |||
ACBD4 | XP_016880573.1 | ACBP | 13..93 | CDD:376410 | 41/80 (51%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165155547 | |
Domainoid | 1 | 1.000 | 102 | 1.000 | Domainoid score | I6845 |
eggNOG | 1 | 0.900 | - | - | E1_COG4281 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1546859at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm40853 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23310 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1702 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.810 |