DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and Acbd6

DIOPT Version :10

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_082526.2 Gene:Acbd6 / 72482 MGIID:1919732 Length:282 Species:Mus musculus


Alignment Length:86 Identity:26/86 - (30%)
Similarity:44/86 - (51%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWN 67
            ::.|.|:.|...::||.:    ..|...:|..|..|||...|..:. .||.|:|..||.||:||.
Mouse    41 SLAELFEKAAAHVQGLVQ----VASREQLLYLYARFKQVKVGNCNT-PKPNFFDFEGKQKWEAWK 100

  Fly    68 DNRHLTKEEAMQRYVESLQEI 88
            .....:..:|||.|:.:::::
Mouse   101 ALGDSSPSQAMQEYIAAVKKL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..83 CDD:459982 26/77 (34%)
Acbd6NP_082526.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
ACBP 43..118 CDD:459982 26/79 (33%)
ANKYR <166..282 CDD:440430
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.