Sequence 1: | NP_608729.1 | Gene: | CG8814 / 33492 | FlyBaseID: | FBgn0031478 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081223.1 | Gene: | Eci3 / 69123 | MGIID: | 1916373 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 42/196 - (21%) |
---|---|---|---|
Similarity: | 61/196 - (31%) | Gaps: | 58/196 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 KPGFWDIVGKAKWQAWNDNRHLTKEEAMQRYVESLQEIIETMSFTENVQNFVGSLDSLGNISLDE 115
Fly 116 LELVSPGMKELAESHPNSPFHSRTNSPQHGSSCNGEPEPEPQATSTAPLATSET-IKENGHSSPP 179
Fly 180 LTNGYGPKPTASYTQHDTHNFTSNSSVAIVDPSDDEYDDPYDLSH------ELTQAIGQNTDLLR 238
Fly 239 Q 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8814 | NP_608729.1 | ACBP | 5..90 | CDD:279259 | 15/38 (39%) |
DUF1664 | <217..272 | CDD:285172 | 6/29 (21%) | ||
Eci3 | NP_081223.1 | ACBP | <2..37 | CDD:376410 | 15/50 (30%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 40..60 | 5/49 (10%) | |||
crotonase-like | 64..256 | CDD:119339 | 18/84 (21%) | ||
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 | 120..124 | 0/3 (0%) | |||
Microbody targeting signal. /evidence=ECO:0000255 | 315..317 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4281 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |