DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and Eci3

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_081223.1 Gene:Eci3 / 69123 MGIID:1916373 Length:317 Species:Mus musculus


Alignment Length:196 Identity:42/196 - (21%)
Similarity:61/196 - (31%) Gaps:58/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KPGFWDIVGKAKWQAWNDNRHLTKEEAMQRYVESLQEIIETMSFTENVQNFVGSLDSLGNISLDE 115
            |||.::.|.||.|.|.|....|.||.|.:.||:                 .|.||.         
Mouse     3 KPGVFNFVNKATWDARNALGSLPKETARKNYVD-----------------LVSSLS--------- 41

  Fly   116 LELVSPGMKELAESHPNSPFHSRTNSPQHGSSCNGEPEPEPQATSTAPLATSET-IKENGHSSPP 179
                                 |.:.:|..|.....|...|    |...|.|||. |.:...:.|.
Mouse    42 ---------------------SSSEAPSQGKRGADEKARE----SKDILVTSEDGITKITFNRPT 81

  Fly   180 LTNGYGPKPTASYTQHDTHNFTSNSSVAIVDPSDDEYDDPYDLSH------ELTQAIGQNTDLLR 238
            ..|....:..........:..|.||.:.:...:.|.|....||.:      |:...:..:|.:||
Mouse    82 KKNAISFQMYLDIMHALKNASTDNSVITVFTGTGDYYSSGNDLKNLINDAGEIQDVVATSTKILR 146

  Fly   239 Q 239
            :
Mouse   147 E 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 15/38 (39%)
DUF1664 <217..272 CDD:285172 6/29 (21%)
Eci3NP_081223.1 ACBP <2..37 CDD:376410 15/50 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60 5/49 (10%)
crotonase-like 64..256 CDD:119339 18/84 (21%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 120..124 0/3 (0%)
Microbody targeting signal. /evidence=ECO:0000255 315..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.