DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and LOC679565

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006237779.1 Gene:LOC679565 / 679565 RGDID:1587118 Length:471 Species:Rattus norvegicus


Alignment Length:470 Identity:116/470 - (24%)
Similarity:167/470 - (35%) Gaps:160/470 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWNDN 69
            |.||:|||.||:.|||||.:||:..|||:||..:|||||| |....:.||||.:|:.||.||:..
  Rat     9 ETRFEAAVKVIQSLPKNGSFQPTNEMMLRFYSFYKQATEG-PCKLSRLGFWDPIGRYKWDAWSSL 72

  Fly    70 RHLTKEEAMQRYVESLQEIIETMSFTENVQNFVGSL-------------------DSLGNISLDE 115
            ..:||||||..|||.:::|||||..||.|:..:..:                   ..|||:....
  Rat    73 GDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLHVIGPFYEIVEDKKNSKSSDLTSDLGNVLTSS 137

  Fly   116 LELVSPGMKELAESHPNSPFHSRTNSPQHGSSCNGEPEPEPQATSTAPLATSETIKENGH----- 175
            ......|..|.::|...|. .........|:..:|..:.:....||.  ...|.|..||:     
  Rat   138 NAKAVKGKAESSDSGAESE-EEEAQDELKGAEQSGSDDKKMMTKSTD--KNLEIIVTNGYKDSFA 199

  Fly   176 --------SSPPLTNGYGPKPTASYTQ----------HDT-----------HNFTSNSSVAIVDP 211
                    ||.........|||...:|          .||           |:.||:|...:...
  Rat   200 QDSDIHTDSSRSARRSEDKKPTDQSSQQTGNTVLCVHQDTNEDPGEDASGVHHLTSDSDSEVYCD 264

  Fly   212 SDDEY-DDPYDLSHELTQAI--------------------------------------------- 230
            |.::: .:.|.|..:..|.:                                             
  Rat   265 SMEQFGQEEYYLGGDPAQHLEGSGFCEDAQLSPGNGSIGKMQMREVKGKGEVKHGGEDGRSSSGA 329

  Fly   231 -------GQNTD-------------------------------------------LLRQIQAAIT 245
                   |::.|                                           |..||...:.
  Rat   330 PHREKRGGESEDFSGVRRGRVGHRMPHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLI 394

  Fly   246 RMNSDVGAVQQRVRSLEQSLNELRSGQ-KAAKGTVAQPRS-LPAWWPFRNISPLWFAVLILWPFL 308
            |:..|:..|.||:..||    .|.:.| |.:..|..||.| .|:|||| .:||...|..|:|||:
  Rat   395 RLQEDMQNVLQRLHKLE----TLTASQAKLSWQTSNQPSSQRPSWWPF-EMSPGALAFAIIWPFI 454

  Fly   309 VRRFARMLQSNPQRR 323
            .:....:.....:|:
  Rat   455 AQWLVHLYYQRRRRK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 46/84 (55%)
DUF1664 <217..272 CDD:285172 16/149 (11%)
LOC679565XP_006237779.1 ACBP 9..96 CDD:238248 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546859at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.