DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and Acbd4

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_080264.1 Gene:Acbd4 / 67131 MGIID:1914381 Length:329 Species:Mus musculus


Alignment Length:360 Identity:98/360 - (27%)
Similarity:149/360 - (41%) Gaps:82/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWNDN 69
            :::|||||:||:.|||||.|:||...||:||..:||||.| |.:..:|||||.:|:.||.|||..
Mouse    11 QKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMG-PCLVPRPGFWDPIGRYKWDAWNRL 74

  Fly    70 RHLTKEEAMQRYVESL----QEIIETMSFTENVQNFVGSLDSLGNISLDELELVSP--------- 121
            ..:::||||..|:..:    |::|:|:...|..::..|..:.|..:..|   :..|         
Mouse    75 GKMSREEAMSAYISEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPD---MPRPPETFLRRAT 136

  Fly   122 GMKELAESHPNSPFHSRTNSPQHGSSC-NGEPEP-----------------------EPQATSTA 162
            |.||        |...|.:......|| ..||.|                       ||:.....
Mouse   137 GWKE--------PLVQREDQAAPEPSCVPKEPVPPSPESRPPRDLDLEVFCDSVEQLEPELVRLP 193

  Fly   163 PLATSETIKENGHSSPPLTNGYGPKPTASYTQHDTHNFTSNSSVAIVDPSDDEYDDPYDLSHELT 227
            .|:......|..|..|.:.:....:..|...:......|:.||                     .
Mouse   194 VLSPVAAEPELCHLPPGIWDSSAQQVWAEQKEAAGRELTTRSS---------------------P 237

  Fly   228 QAIGQNTDL---LRQIQAAITRMNSDVGAVQQRVRSLEQSLNELRSGQKAAKGTVAQPRSLPAWW 289
            ::.|:...|   |...|...|.:...|.|:|:.::.:.:.|..|.|..:..|  ...||:.|  |
Mouse   238 ESTGEKEGLGGGLIGPQELDTWLVGTVRAMQESMKDVHRRLQSLESKPQPLK--QRSPRTRP--W 298

  Fly   290 PF-RNISPLWFAVLILWPFLVRRFARMLQSNPQRR 323
            |. .::..|.|  .|||||:|:...|  |...|:|
Mouse   299 PLGLSVPTLLF--FILWPFVVQWLFR--QFRTQKR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 42/88 (48%)
DUF1664 <217..272 CDD:285172 11/57 (19%)
Acbd4NP_080264.1 ACBP 11..91 CDD:279259 41/80 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845999
Domainoid 1 1.000 102 1.000 Domainoid score I6818
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546859at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42925
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.