DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and Dbil5

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_067607.1 Gene:Dbil5 / 59116 RGDID:68360 Length:87 Species:Rattus norvegicus


Alignment Length:88 Identity:28/88 - (31%)
Similarity:50/88 - (56%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQA 65
            |:.:|  |:.|...:|.|  .||......:::  |..:||||:|..::...|. .|:..||||:|
  Rat     1 MSQVE--FEMACASLKQL--KGPLSDQEKLLV--YSFYKQATQGDCNIPVPPA-TDVKAKAKWEA 58

  Fly    66 WNDNRHLTKEEAMQRYVESLQEI 88
            |..|:.::|.:||:.|:..::|:
  Rat    59 WMVNKGMSKMDAMRIYIAKVEEL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 27/84 (32%)
DUF1664 <217..272 CDD:285172
Dbil5NP_067607.1 ACBP 2..85 CDD:238248 27/87 (31%)
Acyl-CoA binding. /evidence=ECO:0000250 29..33 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349429
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.