DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and eci2

DIOPT Version :10

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001002645.4 Gene:eci2 / 436918 ZFINID:ZDB-GENE-040718-392 Length:392 Species:Danio rerio


Alignment Length:89 Identity:34/89 - (38%)
Similarity:47/89 - (52%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQA 65
            |.|..|.|..|.:.:..|.|:    |...:.||.|.||||||.| |....|||..|.|.|.||.|
Zfish    36 MGASVEDFNKAKDKLNTLKKD----PGNEVKLKIYALFKQATVG-PCNTPKPGMLDFVNKVKWDA 95

  Fly    66 WNDNRHLTKEEAMQRYVESLQEII 89
            |.....:::|:|.|:||:.:..::
Zfish    96 WKGLGSISQEDARQQYVDLISSLV 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..83 CDD:459982 31/77 (40%)
eci2NP_001002645.4 None

Return to query results.
Submit another query.