DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and ACBD7

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001034933.1 Gene:ACBD7 / 414149 HGNCID:17715 Length:88 Species:Homo sapiens


Alignment Length:89 Identity:31/89 - (34%)
Similarity:49/89 - (55%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVD-KKPGFWDIVGKAKWQAW 66
            |::..|..|...::.|..    :|....:.:.|||:|||..|  |:: ..||..|:.|||||:||
Human     2 ALQADFDRAAEDVRKLKA----RPDDGELKELYGLYKQAIVG--DINIACPGMLDLKGKAKWEAW 60

  Fly    67 NDNRHLTKEEAMQRYVESLQEIIE 90
            |..:.|:.|:|...|:...:|:||
Human    61 NLKKGLSTEDATSAYISKAKELIE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 28/85 (33%)
DUF1664 <217..272 CDD:285172
ACBD7NP_001034933.1 ACBP 3..87 CDD:320831 30/88 (34%)
Acyl-CoA binding 30..34 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.