DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and Eci2

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001103801.1 Gene:Eci2 / 23986 MGIID:1346064 Length:391 Species:Mus musculus


Alignment Length:131 Identity:46/131 - (35%)
Similarity:63/131 - (48%) Gaps:8/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQA 65
            |.|.::.|:.|:|.:|.|.|:    |...:.|:.|.|:|||||| |....|||..|.|.||||.|
Mouse    34 MRASQQDFENALNQVKLLKKD----PGNEVKLRLYALYKQATEG-PCNMPKPGMLDFVNKAKWDA 93

  Fly    66 WNDNRHLTKEEAMQRYVESLQEIIETMSFTENVQNFVGSLDSLGNISLDELELVSPGMKELAESH 130
            ||....|.||.|.|.||:.:..:   .|.:|.........|.....|.|.|.....|:.::..:.
Mouse    94 WNALGSLPKETARQNYVDLVSSL---SSSSEAPSQGKRGADEKARESKDILVTSEDGITKITFNR 155

  Fly   131 P 131
            |
Mouse   156 P 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 36/84 (43%)
DUF1664 <217..272 CDD:285172
Eci2NP_001103801.1 ACBP 38..113 CDD:279259 36/79 (46%)
Acyl-CoA binding. /evidence=ECO:0000250 64..68 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..136 3/22 (14%)
crotonase-like 139..389 CDD:304874 4/18 (22%)
ECH-like 149..319 1/8 (13%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.