DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and acbp-4

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_498609.1 Gene:acbp-4 / 186372 WormBaseID:WBGene00018949 Length:146 Species:Caenorhabditis elegans


Alignment Length:100 Identity:37/100 - (37%)
Similarity:60/100 - (60%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWN 67
            :::|:|:|||.:|..||||||.:.|.:..|:.|.|:||||.|:.|. .:|.|:.|..:.||.|||
 Worm     4 SLDEQFEAAVWIINALPKNGPIKTSINDQLQMYSLYKQATSGKCDT-IQPYFFQIEQRMKWNAWN 67

  Fly    68 DNRHLTKEEAMQRYVESLQEIIETMSFTENVQNFV 102
            ...::.:.||..:|||.:.::........|:..|:
 Worm    68 QLGNMDEAEAKAQYVEKMLKLCNQAEAEHNLMEFL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 35/84 (42%)
DUF1664 <217..272 CDD:285172
acbp-4NP_498609.1 ACBP 5..93 CDD:238248 35/88 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5396
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546859at2759
OrthoFinder 1 1.000 - - FOG0004024
OrthoInspector 1 1.000 - - otm14431
orthoMCL 1 0.900 - - OOG6_103494
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.