DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and acbp-5

DIOPT Version :10

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_499817.2 Gene:acbp-5 / 176800 WormBaseID:WBGene00011731 Length:274 Species:Caenorhabditis elegans


Alignment Length:147 Identity:38/147 - (25%)
Similarity:64/147 - (43%) Gaps:30/147 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEERFQAAVNVIKG-LPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWN 67
            :|.:|.||...:.| |.|     .....:||||||:|||.||..|..|.|.:::.|.:.|:.:|.
 Worm    28 LEAKFDAATTRLPGFLTK-----IDQKTILKFYGLYKQAVEGPADSKKGPYWFETVARKKFNSWL 87

  Fly    68 DNRHLTKEEAMQRYVESL----------QEIIETMSFTENVQNFVGSLDSLGNISLDELELVSPG 122
            .|..:::..||:.|.|.:          .|.::.....|.:.:.:|              ::.|.
 Worm    88 ANSQMSRSRAMEAYCELMAQLDTSWDPDAETVKKSGLWEKMPSTMG--------------VIEPE 138

  Fly   123 MKELAESHPNSPFHSRT 139
            |.:.|..||.:...:.|
 Worm   139 MFDDAVVHPPTKLETET 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..83 CDD:459982 28/78 (36%)
acbp-5NP_499817.2 ACBP 29..104 CDD:459982 28/79 (35%)
ANKYR <161..>259 CDD:440430
ANK repeat 188..220 CDD:293786
ANK repeat 222..253 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.