DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and ech-4

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001366707.1 Gene:ech-4 / 174665 WormBaseID:WBGene00001153 Length:385 Species:Caenorhabditis elegans


Alignment Length:225 Identity:64/225 - (28%)
Similarity:101/225 - (44%) Gaps:34/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVD-KKPGFWDIVGKAKWQAWNDNRH 71
            |:.|...:|.|.:    :|...:.|:.||||||||.|  ||. |:||..|.||:||:.|||..:.
 Worm    29 FEKAQKNLKTLKE----EPDNDVKLQLYGLFKQATAG--DVQGKRPGMMDFVGRAKYDAWNTLKG 87

  Fly    72 LTKEEAMQRYVESLQEII--ETMSFTENVQNFVGSLDSLGNISLDELELVSPG-MKELAESHPNS 133
            .|::||...|.:.:..:|  |..:..|...   .|::.|.|:  |.|.:...| :.::|.:.|..
 Worm    88 QTQDEARANYAKLVGGLISEEASAAPEPTG---PSIEGLENV--DGLSVTREGKVFKIALNRPKK 147

  Fly   134 PFHSRTNSPQHGSSCNGEPEPEPQATSTAPLATSETIKENGH---SSPPLTNGYGPKPTASYTQH 195
             |::.|.....|.....|.....::||..      .|..||.   :...|||.   |..|..|:.
 Worm   148 -FNALTLEMYQGIQKALEVSNNDKSTSIT------VITANGSYYCAGNDLTNF---KAAAGGTKE 202

  Fly   196 DTHNFTSNSSVAIVDPSDDEYDDPYDLSHE 225
            ...:..:.:.|.:.|     |.:.| ::||
 Worm   203 QIADMANTAKVIMKD-----YVNAY-INHE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 33/84 (39%)
DUF1664 <217..272 CDD:285172 3/9 (33%)
ech-4NP_001366707.1 ACBP 25..109 CDD:238248 33/85 (39%)
crotonase-like 129..326 CDD:119339 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.