DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and Dbi

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001033088.1 Gene:Dbi / 13167 MGIID:94865 Length:135 Species:Mus musculus


Alignment Length:81 Identity:34/81 - (41%)
Similarity:45/81 - (55%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWNDNRHL 72
            |..|...:|.|..    ||:...||..|..|||||.|..:.| :||..|:.|||||.:||..:..
Mouse    54 FDKAAEEVKRLKT----QPTDEEMLFIYSHFKQATVGDVNTD-RPGLLDLKGKAKWDSWNKLKGT 113

  Fly    73 TKEEAMQRYVESLQEI 88
            :||.||:.|||.:.|:
Mouse   114 SKESAMKTYVEKVDEL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 34/81 (42%)
DUF1664 <217..272 CDD:285172
DbiNP_001033088.1 ACBP 52..134 CDD:238248 34/81 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.