DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8814 and eci2

DIOPT Version :9

Sequence 1:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_012819853.2 Gene:eci2 / 100216270 XenbaseID:XB-GENE-961246 Length:413 Species:Xenopus tropicalis


Alignment Length:212 Identity:60/212 - (28%)
Similarity:88/212 - (41%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAIEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQA 65
            |.|.:|.|:.|.:.:| |.||   .|...:.||.|.||||||:|..:| .|||..|.|.|.||.|
 Frog    56 MQARQEDFEKAQSNLK-LLKN---DPGNEVKLKLYALFKQATQGPCNV-PKPGMLDFVNKVKWDA 115

  Fly    66 WNDNRHLTKEEAMQRYVESLQEIIETMSFTENVQNFVGSLDSLGNISLDELELVSPGMKELAESH 130
            |.....|.|::|.|.|||.:..::.:.|.|::                    ...||:.      
 Frog   116 WKSLGSLPKDDARQSYVELVSSLVSSESSTKS--------------------NADPGIG------ 154

  Fly   131 PNSPFHSRTNSPQHGSSCN------GEPEPEPQATSTAPLATSETIKENG--HSSPPLTNGYGPK 187
                 |.:..:.|.....|      ..||.:...|.|......|.::|.|  .|...:.:|:|  
 Frog   155 -----HKKYETIQVSREDNIIKIFLNRPEKKNAITLTMYKEIGEALEEAGKDESVFAVLSGFG-- 212

  Fly   188 PTASY--TQHDTHNFTS 202
               .|  :.:|.:|||:
 Frog   213 ---DYFCSGNDLNNFTN 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8814NP_608729.1 ACBP 5..90 CDD:279259 36/84 (43%)
DUF1664 <217..272 CDD:285172
eci2XP_012819853.2 ACBP 60..131 CDD:412233 33/75 (44%)
crotonase-like 161..411 CDD:419961 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.