DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and AT1G14260

DIOPT Version :10

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_172878.1 Gene:AT1G14260 / 837987 AraportID:AT1G14260 Length:265 Species:Arabidopsis thaliana


Alignment Length:83 Identity:25/83 - (30%)
Similarity:41/83 - (49%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 DPSIPTLNAETNKLSPEEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVES 429
            |.:|...:.:|.:  .||..|.::..:|.||.|....:.|..||.|.|.:...|.:|::||    
plant    32 DNAIDIYDGDTTE--NEEEDSLISSAECRICQDECDIKNLESPCACNGSLKYAHRKCVQRW---- 90

  Fly   430 CSNSEAQLSCKVCGHPYE 447
            | |.:....|::|..||:
plant    91 C-NEKGNTICEICHQPYQ 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 19/59 (32%)
RING_CH-C4HC3_MARCH 392..443 CDD:438158 16/50 (32%)
AT1G14260NP_172878.1 RINGv 57..103 CDD:128983 16/50 (32%)
DUF3675 109..226 CDD:463576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.