DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and AT5G38070

DIOPT Version :10

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_198623.1 Gene:AT5G38070 / 833787 AraportID:AT5G38070 Length:259 Species:Arabidopsis thaliana


Alignment Length:212 Identity:51/212 - (24%)
Similarity:80/212 - (37%) Gaps:64/212 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 DPSIPTLNAETNKLSPEEGQSFLTKK--DCWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLV 427
            ||...::|.:....|...|......|  .|.||:|.|:...:..||.|:|.:...||.|::||  
plant    25 DPKADSVNEDGVSESISAGADLCESKFVQCRICHDEDEDTNMDTPCSCSGTLKFAHHNCVQRW-- 87

  Fly   428 ESCSNSEAQLSCKVCGHPYE--------------IEKSKKLEWD-KGFTIQH-----W------- 465
              | |.:....|::|...|:              |..:...:|. :|..:::     |       
plant    88 --C-NEKGDTVCEICRQQYKPGYTAPRQLFHYTGISMNFGSDWGIEGLDLRNPYFLTWGDADDDH 149

  Fly   466 ------SKTVI----LITLMCV------------TGATAWVVIQMYVDPLVRVMTVGIAVLIGYV 508
                  |.|.:    ||.|:.|            .|......|.:.:.||||  |:|| :||.||
plant   150 DLYSFHSPTSLICCRLIALLFVLLLFLRHSLPVLLGGVDDFSITLLMLPLVR--TLGI-LLIAYV 211

  Fly   509 CVKCLGENTVVAYQRAK 525
            ..|     :.:..||.:
plant   212 FFK-----SFIVIQRCR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 33/155 (21%)
RING_CH-C4HC3_MARCH 392..443 CDD:438158 17/50 (34%)
AT5G38070NP_198623.1 RINGv 53..100 CDD:128983 17/51 (33%)
DUF3675 105..216 CDD:463576 24/118 (20%)

Return to query results.
Submit another query.