DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and AT3G47550

DIOPT Version :10

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_190339.1 Gene:AT3G47550 / 823909 AraportID:AT3G47550 Length:288 Species:Arabidopsis thaliana


Alignment Length:67 Identity:21/67 - (31%)
Similarity:36/67 - (53%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 EEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHP 445
            :|.:..|...:|.||.:.|..:.|..||.|.|.:...|.:|::||    | |.:..::|::|..|
plant    58 DEEEPLLQSVECRICQEEDSTKNLEAPCACNGSLKYAHRKCVQRW----C-NEKGDITCEICHQP 117

  Fly   446 YE 447
            |:
plant   118 YQ 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 19/59 (32%)
RING_CH-C4HC3_MARCH 392..443 CDD:438158 16/50 (32%)
AT3G47550NP_190339.1 RINGv 69..115 CDD:128983 16/50 (32%)
DUF3675 121..237 CDD:463576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.