DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and AT3G06710

DIOPT Version :10

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_187327.2 Gene:AT3G06710 / 819856 AraportID:AT3G06710 Length:245 Species:Arabidopsis thaliana


Alignment Length:39 Identity:12/39 - (30%)
Similarity:20/39 - (51%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 MYVDPLVR-VMTVGIAVLIGYVCVKC--LGENTVVAYQR 523
            |...|.|| |:...:|.::...|:..  ||:..||.::|
plant     1 MRASPYVRMVVPWAMAFILNTYCLSLHPLGQEVVVGFKR 39

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 2/5 (40%)
RING_CH-C4HC3_MARCH 392..443 CDD:438158
AT3G06710NP_187327.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.