powered by:
Protein Alignment CG2991 and Marchf5
DIOPT Version :9
Sequence 1: | NP_608725.1 |
Gene: | CG2991 / 33488 |
FlyBaseID: | FBgn0031474 |
Length: | 562 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001365726.1 |
Gene: | Marchf5 / 69104 |
MGIID: | 1915207 |
Length: | 292 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 39/73 - (53%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 380 PEEGQSFLTKKDCWICY---DSDKPEPLIQPCRCTGDVSSVHHECLKRWLVE-SCSNSEAQLSCK 440
|::....:..:.||:|: :.|:....::||||.|....||..||:||:.| ...||.|:::|.
Mouse 2 PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACP 66
Fly 441 VCGHPYEI 448
.|...|.|
Mouse 67 QCNAEYLI 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1210654at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.