DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and Marchf10

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_766156.2 Gene:Marchf10 / 632687 MGIID:2443469 Length:788 Species:Mus musculus


Alignment Length:93 Identity:29/93 - (31%)
Similarity:45/93 - (48%) Gaps:18/93 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 NPRKLLSRQIDPSIPTLNAETNKLSPEEGQSFLTKKDCWICY--DSDKPEPLIQPCRCTGDVSSV 417
            :|.||  |::..|:...::|     .|||..      |.||.  ......||::||.|.|.:..|
Mouse   615 DPEKL--RKLQESLLEEDSE-----EEEGDL------CRICQIAGGSPANPLLEPCGCVGSLQFV 666

  Fly   418 HHECLKRWL---VESCSNSEAQLSCKVC 442
            |.||||:||   :.|.::.....:|::|
Mouse   667 HQECLKKWLKVKITSGADLGTVKTCEMC 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 20/59 (34%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 20/56 (36%)
Marchf10NP_766156.2 RING_CH-C4HC3_MARCH10 639..698 CDD:319727 20/56 (36%)
RING-CH finger (C4HC3-type) 639..694 CDD:319727 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.