DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and marchf4

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001025336.1 Gene:marchf4 / 562065 ZFINID:ZDB-GENE-041210-304 Length:378 Species:Danio rerio


Alignment Length:220 Identity:49/220 - (22%)
Similarity:90/220 - (40%) Gaps:53/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 SFLTKKD----CWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHP 445
            ||::..:    |.||:...:...|:.||||:|.|.|.|..||.:|:.|     ....:|::|.:.
Zfish    97 SFISYAEGTPVCRICFQGPEKGELLSPCRCSGSVRSTHQPCLIKWISE-----RGSWTCELCYYK 156

  Fly   446 YE---IEKSKKLEWDKGFTIQHWSKTVI--------LITLMCVTGATAWVV-------IQMYVDP 492
            |:   |.....|:|      |..|.|||        ::..:.:..:.:|:|       .:.....
Zfish   157 YQVIAISTKNPLQW------QAISLTVIEKVQIAAAILGSLFLIASISWLVWSSLSPSAKWQRQD 215

  Fly   493 LVRVMTVGIAVLIGYVCVKCL---GENTVVAY-------QRAKVSSINIVTSSEMEK-----LHT 542
            |:..:..|:...:..||:..:   |.:....:       |:.||.:.:....||.:|     ..|
Zfish   216 LLFQICYGMYGFMDVVCIALIVHEGPSVFRIFHRWQAVNQQWKVLNYDKKRDSEQQKSSEEQTQT 280

  Fly   543 ICEE-----VSASTSAEAVRAGAAS 562
            :.::     .:.|.|..::.|.|||
Zfish   281 LVQQRENTGSNISPSLSSILAAAAS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 29/126 (23%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 17/50 (34%)
marchf4NP_001025336.1 RINGv 107..153 CDD:128983 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.