DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and MARCHF5

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_060294.1 Gene:MARCHF5 / 54708 HGNCID:26025 Length:278 Species:Homo sapiens


Alignment Length:163 Identity:36/163 - (22%)
Similarity:64/163 - (39%) Gaps:44/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 PEEGQSFLTKKDCWICY---DSDKPEPLIQPCRCTGDVSSVHHECLKRWLVE-SCSNSEAQLSCK 440
            |::....:..:.||:|:   :.|:....::||||.|....||..||:||:.| ...||.|:::|.
Human     2 PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACP 66

  Fly   441 VCGHPYEIEKSK-----------------------------KLEWDKGFTIQHWSKTVILITLMC 476
            .|...|.|...|                             .:.|.        :.|...:|:|.
Human    67 QCNAEYLIVFPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWT--------AVTYGAVTVMQ 123

  Fly   477 VTGATAWVVIQMYVDP---LVRVMTVGIAVLIG 506
            |.|....:.:....||   |:.:.|:.:.:::|
Human   124 VVGHKEGLDVMERADPLFLLIGLPTIPVMLILG 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 32/140 (23%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 20/54 (37%)
MARCHF5NP_060294.1 RING_CH-C4HC3_MARCH5 12..72 CDD:319615 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.