DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and Marchf11

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001095298.1 Gene:Marchf11 / 499558 RGDID:1559945 Length:398 Species:Rattus norvegicus


Alignment Length:149 Identity:37/149 - (24%)
Similarity:64/149 - (42%) Gaps:27/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 CWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPYE---IEKSKK 453
            |.||:...:...|:.||||.|.|...|..||.:|:.|     ....:|::|.:.|.   |:..:.
  Rat   166 CKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKWISE-----RGSWTCELCCYRYHVTAIKMKQP 225

  Fly   454 LEWDKGFTIQHWSK----TVILITLMCVTGAT--AWVVIQMYV-----DPLVRVMTVGIAVLIGY 507
            .:| :..:|....|    .|||.:|..:...|  .|.....|.     |.|.:: ..|   :.|:
  Rat   226 CQW-QSISITLVEKVQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQI-CYG---MYGF 285

  Fly   508 VCVKCLGENTVVAYQRAKV 526
            :.:.|:|   ::.::.|.|
  Rat   286 MDLVCIG---LIVHEGAAV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 30/115 (26%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 16/50 (32%)
Marchf11NP_001095298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158
RING_CH-C4HC3_MARCH4_like 165..215 CDD:319614 17/53 (32%)
YXXL motif 367..370
PDZ-binding 395..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.