DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and CG4080

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster


Alignment Length:184 Identity:47/184 - (25%)
Similarity:79/184 - (42%) Gaps:51/184 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 CWICY-DSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPYEIEKSKK-- 453
            |.||: :||...||:.||.|:|.:..||..||::||..|.:|     ||::|..|:.:....|  
  Fly    43 CRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETN-----SCELCKFPFIMHTKIKPF 102

  Fly   454 LEWDKGFTIQ-------------HWSKTVILITLMCVTGATAWVVIQMYVDPLVR---------- 495
            .|| :...|.             |.:..:.:|..:|       |:|:...|.:.|          
  Fly   103 NEW-RSLDISGIERRRLCYSVLFHCAAALCVIWSLC-------VLIERAADDVQRGLIDWPFWTK 159

  Fly   496 --VMTVGIAVLIGYVCVKCLGENTVVAY----QRAKVSSINIVTSSEMEKLHTI 543
              |:|||:...|.::.::|      .||    .|.|..:..::..:..||:|.:
  Fly   160 LAVVTVGLTGGIVFMYIQC------KAYLHLCHRWKARNRILLIQNAPEKIHPV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 33/117 (28%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 21/51 (41%)
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.