DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and CG1317

DIOPT Version :10

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster


Alignment Length:119 Identity:31/119 - (26%)
Similarity:53/119 - (44%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 CWICYDSDKPE-PLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPYEIEKSKKLE 455
            |.:|....:|: ||..||.|||.:..:|.:||..|:  ..|:.|   .|::|.:.:..:.....:
  Fly    10 CRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWM--RYSHKE---YCELCSYSFSFQPIYAPD 69

  Fly   456 WDKGFTIQHWSKTVILITLM--CVTGATAWVVIQMYVDPLVRVMTVGIAVLIGY 507
            ..:...|:.     :|:.||  .:.||..|:   .|.  ||.:...|:..|..|
  Fly    70 MPRVLPIKD-----VLVGLMSAVLEGARCWL---HYT--LVGLAWFGVVPLSAY 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 26/104 (25%)
RING_CH-C4HC3_MARCH 392..443 CDD:438158 17/51 (33%)
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 31/119 (26%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 18/52 (35%)
SSM4 <359..>554 CDD:227510
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.