DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and CG13442

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster


Alignment Length:135 Identity:40/135 - (29%)
Similarity:64/135 - (47%) Gaps:28/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 LNAE--TNKLSPEEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVES-CSN 432
            ||.|  :|:..|..|...     |.||:::|.||.|:.||.|.|.::.||..||:.|:..| |: 
  Fly   149 LNYESASNESMPSVGSLV-----CRICHNADNPEQLVSPCLCKGSLTYVHVHCLECWISTSRCT- 207

  Fly   433 SEAQLSCKVCGHPYEIE--------KSKKLEWDKGFT---IQHWSKTVILITLMC--VTGATAWV 484
                 :|::|...|..|        :|.:|.:.:..:   :|...:...|:||:.  :.| |..|
  Fly   208 -----TCELCQFQYNTEQTLRYTCLQSLRLWYSRAMSRRALQEDCQMFSLLTLVAFGIIG-TLLV 266

  Fly   485 VIQMY 489
            .||.|
  Fly   267 GIQYY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 34/115 (30%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 19/51 (37%)
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606 1/1 (100%)
RINGv 166..213 CDD:128983 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.