DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and sta-2

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001122963.1 Gene:sta-2 / 3565291 WormBaseID:WBGene00010251 Length:567 Species:Caenorhabditis elegans


Alignment Length:235 Identity:48/235 - (20%)
Similarity:80/235 - (34%) Gaps:79/235 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GPFTPDNDLSC---SGRGDCVNNTCVCDIRYAGNECDIFNLPYYAGISTVFYVVALVSVIQLLIC 102
            |.|...::||.   .|..:|.::  :...:.|.||    .||:            :...:|:...
 Worm    26 GAFVSKHNLSAEAYQGFKECADS--LLSGKIAQNE----QLPF------------IQRTLQICEN 72

  Fly   103 IVAEYQRLKQ---PSVLRACRITTQKL---------LYFMVFVAASLRGAYF-------TTPLDL 148
            ::..::..||   ..||....:..|||         |::......:|:..||       .:.||.
 Worm    73 VILNFEDEKQHLMSDVLLVWAMKQQKLSIATLHTQQLHYKELDLINLQFEYFGELLQQTLSGLDY 137

  Fly   149 QPQW--------------AVTLMSAYYPLLMT--CASLIV-CMWAEIFHLRDIRWEKSQFLSKSF 196
            ..|:              .:|....||.::::  ..|:|| |..|| .|.|...|..::.   ..
 Worm   138 LKQYYPNVGFEEVHSKVRNLTHYFLYYSIIVSRQPPSVIVKCGEAE-NHRRSRFWFNTEI---RI 198

  Fly   197 LGFVAFNFFLYSLFGIEVFNSLINAERRDYAHIFNGCYAV 236
            ||        .|.|||:..|...|.          .||.:
 Worm   199 LG--------GSAFGIDTNNENSNV----------NCYLI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510
RING_CH-C4HC3_MARCH 392..443 CDD:319409
sta-2NP_001122963.1 STAT_bind 167..>359 CDD:280939 19/76 (25%)
SH2_STAT_family 433..545 CDD:198175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.