DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and march5l

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_956033.2 Gene:march5l / 326067 ZFINID:ZDB-GENE-030131-4792 Length:289 Species:Danio rerio


Alignment Length:146 Identity:40/146 - (27%)
Similarity:63/146 - (43%) Gaps:28/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 KKDCWICYDSDKPE---PLIQPCRCTGDVSSVHHECLKRWLVE-SCSNSEAQLSCKVCGHPYEI- 448
            :|.||:|:.::|.:   ..:.||||.|....:|..||:|||.| ...||...:||..||..|.| 
Zfish     9 EKHCWVCFATEKEDRAAEWVSPCRCKGCTKWIHQSCLQRWLDEKQKGNSGGAVSCPQCGTEYRIV 73

  Fly   449 ------------EKSKKLEWDKGFTIQ-------HWSK-TVILITLMCVTGATAWVVIQMYVDPL 493
                        :..:.|.....|...       :||. |...:|:|.|.|....:.:....|||
Zfish    74 FPKMGPVVYFLQQVDRALSRASPFAAAGVVVGTVYWSAVTYGAVTVMQVVGHKKGLDVMERADPL 138

  Fly   494 VRVM---TVGIAVLIG 506
            ..:|   |:.:.:::|
Zfish   139 FLLMGLPTIPVMLVLG 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 36/129 (28%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 20/54 (37%)
march5lNP_956033.2 RINGv 11..67 CDD:128983 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.