DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and Marchf8

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_008761465.1 Gene:Marchf8 / 312656 RGDID:1309339 Length:568 Species:Rattus norvegicus


Alignment Length:333 Identity:79/333 - (23%)
Similarity:125/333 - (37%) Gaps:97/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 NASQLHQSRFGLLFQAVMLIVIVGFLTSETLGDFWKTKVPVNSRNWHDIIFRIAEIGVALWFPCC 341
            :||:||.::     .:..|...:||.:.| :||              |.:|..|           
  Rat   279 HASRLHTAK-----SSSWLAGSMGFCSDE-MGD--------------DDVFEDA----------- 312

  Fly   342 LWNSMAPEQLWILN-PRKLLSRQIDPSIPTLNAETNKLSPEEGQSFLTKKD-CWICY-DSDKPEP 403
               |.|..:..:|. |...:.:..|...|::.:|  |.:|....|  |..| |.||: :.|...|
  Rat   313 ---SSAKLKNRVLRAPLCSVEKDSDLDCPSVLSE--KCTPISPVS--TSGDACRICHCEGDDESP 370

  Fly   404 LIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPYEIE-KSKKL-EWDK-------- 458
            ||.||.|||.:..||..||::|:..|.:.     .|::|.:.:.:| |.|.| :|:|        
  Rat   371 LITPCHCTGSLHFVHQACLQQWIKSSDTR-----CCELCKYEFIMETKLKPLRKWEKLQMTASER 430

  Fly   459 ------------GFTIQHWSKTVIL------ITLMCVTGATAWVVIQMYVDPLVRVMTVGIAVLI 505
                        ..|...||..|::      |....|||...|......|     |:.:|....:
  Rat   431 RKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQVTGILEWPFWTKLV-----VVAIGFTGGL 490

  Fly   506 GYVCVKC----------LGENTVVAYQRA-KVSSINIVTSS-------EMEKLHTICEEVSASTS 552
            .::.|:|          ...|.|:..|.. :.|..||...|       |.::.|.:|...:.|:.
  Rat   491 LFMYVQCKVYLQLWKRLKAYNRVIYVQNCPETSKKNIFEKSALTEPTLENKEGHGMCHSTTNSSC 555

  Fly   553 AEAVRAGA 560
            .|....||
  Rat   556 TEPEDTGA 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 37/134 (28%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 19/51 (37%)
Marchf8XP_008761465.1 RING_CH-C4HC3_MARCH1_like 357..408 CDD:319612 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.