DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and Marchf7

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_038960759.1 Gene:Marchf7 / 311059 RGDID:1308993 Length:713 Species:Rattus norvegicus


Alignment Length:153 Identity:43/153 - (28%)
Similarity:63/153 - (41%) Gaps:35/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 VPVNSRNWHDIIFRIAEIGVALWFPCCLWNSMAPEQLWI-LNPRKLLSRQIDP---SIPTLNAET 375
            :|...||          .|:|...|..|:....|..|.. |.....::..|.|   |.....:|.
  Rat   480 LPQGGRN----------TGIAGILPGSLFRFAVPPALGSNLTDNVTITVDIIPSGWSSADGKSEK 534

  Fly   376 NKLSPEEGQSFLTK-KDCWICYDSDKPEP-----------------LIQPCRCTGDVSSVHHECL 422
            .|.:|......|.| |:..:..|||:.|.                 ||:||:|||.:..||.||:
  Rat   535 AKSAPSRDPEKLQKIKESLLLEDSDEEEEGDLCRICQMAAASSSNLLIEPCKCTGSLQYVHQECM 599

  Fly   423 KRWL---VESCSNSEAQLSCKVC 442
            |:||   :.|.|:.||..:|::|
  Rat   600 KKWLQAKINSGSSLEAVTTCELC 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 26/75 (35%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 24/71 (34%)
Marchf7XP_038960759.1 RING_CH-C4HC3_MARCH7 564..625 CDD:319726 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.