DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and Marchf2

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_663461.2 Gene:Marchf2 / 224703 MGIID:1925915 Length:287 Species:Mus musculus


Alignment Length:161 Identity:39/161 - (24%)
Similarity:67/161 - (41%) Gaps:49/161 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 ETNKLSPEEGQSFLTKKD-------------------CWICYDSDKPEPLIQPCRCTGDVSSVHH 419
            |...|.|.:..:.:|.:|                   |.||::....|.|:.||.|||.:.:||.
Mouse    27 EATGLGPPQYVAQVTSRDGRLLSTVIRALDSQSDCPFCRICHEGANGENLLSPCGCTGTLGAVHK 91

  Fly   420 ECLKRWLVESCSNSEAQLSCKVCGHPYEIEKSKK--LEW--DKGFTIQHWSKTVILITLMCVTGA 480
            .||::||  |.||:.   .|::|...:.:||..:  .||  |.|   ....|..:...::|.   
Mouse    92 SCLEKWL--SSSNTS---YCELCHTEFAVEKRPRPLTEWLKDPG---PRTEKRTLCCDMVCF--- 145

  Fly   481 TAWVVIQMYVDPLVRVMTVGIAVLIGYVCVK 511
                   :::.||        |.:.|::|::
Mouse   146 -------VFITPL--------AAISGWLCLR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 31/127 (24%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 20/50 (40%)
Marchf2NP_663461.2 RINGv 63..110 CDD:128983 20/51 (39%)
Vpu 173..>224 CDD:109608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.