DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and Marchf9

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001028434.1 Gene:Marchf9 / 216438 MGIID:2446144 Length:348 Species:Mus musculus


Alignment Length:161 Identity:40/161 - (24%)
Similarity:66/161 - (40%) Gaps:31/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 SFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPYE-- 447
            |.|....|.||:...:...|:.||||.|.|...|..||.||:.|     ....||::|...|:  
Mouse   103 SGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISE-----RGSWSCELCYFKYQVL 162

  Fly   448 -IEKSKKLEWDKGFTIQHWSKTV--------ILITLMCVTGATAWVVIQMYVDPLVRVMTVGIAV 503
             |.....|:|      |..|.||        |::..:.:..:.:| :|...:.|..:.....:..
Mouse   163 AISTKNPLQW------QAISLTVIEKVQIAAIVLGSLFLVASISW-LIWSSLSPSAKWQRQDLLF 220

  Fly   504 LI-----GYVCVKCLGENTVVAYQRAKVSSI 529
            .|     |::.|.|:|   ::.::.:.|..|
Mouse   221 QICYGMYGFMDVVCIG---LIVHEGSSVYRI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 31/115 (27%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 18/50 (36%)
Marchf9NP_001028434.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..96
RINGv 109..155 CDD:128983 18/50 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.