Sequence 1: | NP_608725.1 | Gene: | CG2991 / 33488 | FlyBaseID: | FBgn0031474 | Length: | 562 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_808265.2 | Gene: | Marchf11 / 211147 | MGIID: | 3608327 | Length: | 400 | Species: | Mus musculus |
Alignment Length: | 225 | Identity: | 47/225 - (20%) |
---|---|---|---|
Similarity: | 80/225 - (35%) | Gaps: | 73/225 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 356 PRKLLSRQIDPSIPTLNAETNKLSPEEGQSFLTKKD----------------------------- 391
Fly 392 -----------CWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHP 445
Fly 446 YE---IEKSKKLEWDKGFTIQHWSK----TVILITLMCVTGAT--AWVVIQMYV-----DPLVRV 496
Fly 497 MTVGIAVLIGYVCVKCLGENTVVAYQRAKV 526 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2991 | NP_608725.1 | SSM4 | 389..>494 | CDD:227510 | 30/158 (19%) |
RING_CH-C4HC3_MARCH | 392..443 | CDD:319409 | 16/50 (32%) | ||
Marchf11 | NP_808265.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..160 | 10/67 (15%) | |
RINGv | 167..213 | CDD:128983 | 16/50 (32%) | ||
YXXL motif | 369..372 | ||||
PDZ-binding | 397..400 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |