DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and marc-5

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_496624.3 Gene:marc-5 / 174876 WormBaseID:WBGene00013273 Length:601 Species:Caenorhabditis elegans


Alignment Length:198 Identity:44/198 - (22%)
Similarity:70/198 - (35%) Gaps:53/198 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 CWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPYEIE-----KS 451
            |..|:..|..:|||.||||:|.:..||..||..||..|.........|::|.:.|...     :.
 Worm   328 CHCCWPPDSNDPLISPCRCSGSLQYVHVSCLMHWLDISSRKLHRPAICELCLYKYRRRRVLKYRE 392

  Fly   452 KKLEWDKGFTIQHWSKTVILITLMCVTGATAWVVIQMYVDPLVRVMTVGIAVLIGYVCVKCLGEN 516
            .||.......|:.::..|:.|.||.::..:..|..|:                     .|..|.:
 Worm   393 MKLPQCAQADIRFYTLFVVAIVLMILSAFSTVVCFQL---------------------EKSYGLS 436

  Fly   517 TVVAYQRAKVSSIN------------------IVTSSEMEKLHTIC---------EEVSASTSAE 554
            :.....|.:...:|                  :.|:||...:.|:.         ..|:|||..|
 Worm   437 SSQGELRNRTQPLNVEGVVSDVPPAAPPSLTAVATASEESSVPTVVLGARKRIGDITVNASTKDE 501

  Fly   555 AVR 557
            :.|
 Worm   502 SYR 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 30/106 (28%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 19/50 (38%)
marc-5NP_496624.3 RING_CH-C4HC3_MARCH 325..378 CDD:319409 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.