DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and marc-6

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_492823.2 Gene:marc-6 / 172986 WormBaseID:WBGene00018847 Length:1025 Species:Caenorhabditis elegans


Alignment Length:205 Identity:49/205 - (23%)
Similarity:78/205 - (38%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PSIPTLNAETNKLSPEEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESC 430
            ||.|.::...:.|.            |.:|..::  ..|..||.|||.:..||.|||..||  ..
 Worm    39 PSDPIIDDNDDHLM------------CRVCRGNE--GSLYYPCLCTGSIKYVHQECLVEWL--KY 87

  Fly   431 SNSEAQLSCKVCGHPYEIEKSKKLEWDKGFTIQHWSKTVILITLMCVTGA---TAWVVIQMYVDP 492
            |..|.   |::|.|.|..:...:.:..|...|....:.|:      ::||   ..|::..:    
 Worm    88 SKKEV---CELCNHKYSFQPIYRQDMPKALPILEILRGVL------ISGAIMVRTWIIYTI---- 139

  Fly   493 LVRVMT--VGIAVLIG---YVCVKCLGENTVV--AYQRAKVSS-INIVTSSEMEKLHTICEEVSA 549
               |||  :||..|..   |.|:..|..:.:|  .:|..|... .|.:....:..|..:|..:|.
 Worm   140 ---VMTTWLGIVPLTAARIYNCIFYLSFHDIVNAPFQLFKAEHFFNDILKGSLLLLVFVCTFISL 201

  Fly   550 STSAEAVRAG 559
            ....|.:..|
 Worm   202 VWLREQIIIG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 27/107 (25%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 18/50 (36%)
marc-6NP_492823.2 SSM4 47..1016 CDD:227510 46/197 (23%)
RING_CH-C4HC3_MARCH6 52..98 CDD:319616 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.