Sequence 1: | NP_608725.1 | Gene: | CG2991 / 33488 | FlyBaseID: | FBgn0031474 | Length: | 562 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492823.2 | Gene: | marc-6 / 172986 | WormBaseID: | WBGene00018847 | Length: | 1025 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 78/205 - (38%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 366 PSIPTLNAETNKLSPEEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESC 430
Fly 431 SNSEAQLSCKVCGHPYEIEKSKKLEWDKGFTIQHWSKTVILITLMCVTGA---TAWVVIQMYVDP 492
Fly 493 LVRVMT--VGIAVLIG---YVCVKCLGENTVV--AYQRAKVSS-INIVTSSEMEKLHTICEEVSA 549
Fly 550 STSAEAVRAG 559 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2991 | NP_608725.1 | SSM4 | 389..>494 | CDD:227510 | 27/107 (25%) |
RING_CH-C4HC3_MARCH | 392..443 | CDD:319409 | 18/50 (36%) | ||
marc-6 | NP_492823.2 | SSM4 | 47..1016 | CDD:227510 | 46/197 (23%) |
RING_CH-C4HC3_MARCH6 | 52..98 | CDD:319616 | 19/64 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5183 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |