DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and marc-4

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001348646.1 Gene:marc-4 / 171616 WormBaseID:WBGene00016903 Length:317 Species:Caenorhabditis elegans


Alignment Length:202 Identity:52/202 - (25%)
Similarity:83/202 - (41%) Gaps:47/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 APEQLWILNPRKLLSRQ---IDPSIPT-------LNAE---TNKLSPEEGQSFLTKKDCWICY-- 396
            ||.|...|....|:..:   ||.|..|       |.|.   ::|||.:...:.:    |.||:  
 Worm    26 APSQPNRLEKEPLIDEETDMIDESRATYWKGCEFLKASGLYSSKLSLQSASANM----CRICHTS 86

  Fly   397 DSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPY---EIEKSKKLEWDK 458
            .|.:..|||.||||:|.:..||..|:.|||..|.........|::||:.|   .|.:.|.|.   
 Worm    87 TSTRSNPLISPCRCSGTLLFVHKACVVRWLEMSTRKMVPSPRCELCGYDYRRGNIFQMKSLH--- 148

  Fly   459 GFTIQHWSKTVILITLMCVTGATAWVVIQMYVDPLVRVMTVGIAVLIGYVCVKCLGENTVVAYQR 523
               :.|..::..|:.::.                   ::||.|.:..||..::.:.||.::..:.
 Worm   149 ---VPHVDRSSCLLNVLF-------------------LITVLIMIFCGYFTIQFIQENALLKRRL 191

  Fly   524 AKVSSIN 530
            ...||.|
 Worm   192 FAHSSTN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 28/109 (26%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 20/52 (38%)
marc-4NP_001348646.1 RING_CH-C4HC3_MARCH 80..133 CDD:319409 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.