DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2991 and marchf11

DIOPT Version :9

Sequence 1:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_002933170.1 Gene:marchf11 / 100487933 XenbaseID:XB-GENE-982895 Length:287 Species:Xenopus tropicalis


Alignment Length:153 Identity:36/153 - (23%)
Similarity:69/153 - (45%) Gaps:29/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 CWICYDSDKPEPLIQPCRCTGDVSSVHHECLKRWLVESCSNSEAQLSCKVCGHPYE---IEKSKK 453
            |.||:...:...|:.||||.|.|...|..||.:|:.|     ....:|::|.:.|:   |...:.
 Frog    54 CKICFQGPEQGELLNPCRCDGSVRYTHQLCLLKWISE-----RGSWTCELCCYRYQVIAIRMKRP 113

  Fly   454 LEWDKGFTIQHWSK----TVILITLMCVTGATAWVV--------IQMYVDPLVRVMTVGIAVLIG 506
            .:| :..|:....|    .|||.:|..::..| |::        :....|.|.:: ..|   :.|
 Frog   114 CQW-QCITVTLVEKVQMIAVILGSLFLISSVT-WLLWSAFSPQAVWQRKDILFQI-CYG---MYG 172

  Fly   507 YVCVKCLGENTVVAYQRAKVSSI 529
            ::.:.|:|   ::.::.|.|.::
 Frog   173 FMDLVCIG---LIVHEGAAVYTV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 29/116 (25%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 16/50 (32%)
marchf11XP_002933170.1 RING_Ubox 54..103 CDD:388418 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.