DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS21 and RPS21A

DIOPT Version :9

Sequence 1:NP_001259970.1 Gene:RpS21 / 33487 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_012983.3 Gene:RPS21A / 853931 SGDID:S000001765 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:49/83 - (59%)
Similarity:61/83 - (73%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS-KTYAICGEIRRMGE 64
            ||||.|:.|:|||||||||:||||.|.||||||:::..|| |.||...|. .|||:.|.:|..||
Yeast     1 MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVD-EEGRAIPGEYVTYALSGYVRSRGE 64

  Fly    65 SDDCIVRLAKKDGIITKN 82
            |||.:.|||:.||:: ||
Yeast    65 SDDSLNRLAQNDGLL-KN 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS21NP_001259970.1 Ribosomal_S21e 1..77 CDD:279574 45/76 (59%)
RPS21ANP_012983.3 Ribosomal_S21e 1..80 CDD:396001 47/80 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I1750
eggNOG 1 0.900 - - E1_KOG3486
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90915
Inparanoid 1 1.050 91 1.000 Inparanoid score I1539
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54242
OrthoFinder 1 1.000 - - FOG0002785
OrthoInspector 1 1.000 - - otm46671
orthoMCL 1 0.900 - - OOG6_101819
Panther 1 1.100 - - O PTHR10442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1875
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.