DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS21 and RPS21A

DIOPT Version :10

Sequence 1:NP_722853.1 Gene:RpS21 / 33487 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_012983.3 Gene:RPS21A / 853931 SGDID:S000001765 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:49/83 - (59%)
Similarity:61/83 - (73%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS-KTYAICGEIRRMGE 64
            ||||.|:.|:|||||||||:||||.|.||||||:::..|| |.||...|. .|||:.|.:|..||
Yeast     1 MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVD-EEGRAIPGEYVTYALSGYVRSRGE 64

  Fly    65 SDDCIVRLAKKDGIITKN 82
            |||.:.|||:.||:: ||
Yeast    65 SDDSLNRLAQNDGLL-KN 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS21NP_722853.1 Ribosomal_S21e 1..79 CDD:460133 47/78 (60%)
RPS21ANP_012983.3 Ribosomal_S21e 1..80 CDD:460133 47/80 (59%)

Return to query results.
Submit another query.