DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS21 and AT5G27700

DIOPT Version :9

Sequence 1:NP_001259970.1 Gene:RpS21 / 33487 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_198122.4 Gene:AT5G27700 / 832832 AraportID:AT5G27700 Length:82 Species:Arabidopsis thaliana


Alignment Length:81 Identity:37/81 - (45%)
Similarity:55/81 - (67%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSKTYAICGEIRRMGES 65
            |:|:.|:..:||:||||||:||:|.:||||||||:|..:| ..|..|....|:|:||.:|..|::
plant     1 MQNEEGQVTELYIPRKCSATNRLITSKDHASVQLNIGHLD-ANGLYTGQFTTFALCGFVRAQGDA 64

  Fly    66 DDCIVRLAKKDGIITK 81
            |..:.||.:|..:..|
plant    65 DSGVDRLWQKKKVEAK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS21NP_001259970.1 Ribosomal_S21e 1..77 CDD:279574 36/75 (48%)
AT5G27700NP_198122.4 Ribosomal_S21e 1..77 CDD:396001 36/76 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I3064
eggNOG 1 0.900 - - E1_KOG3486
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90915
Inparanoid 1 1.050 79 1.000 Inparanoid score I2382
OMA 1 1.010 - - QHG54242
OrthoDB 1 1.010 - - D1571849at2759
OrthoFinder 1 1.000 - - FOG0002785
OrthoInspector 1 1.000 - - otm3444
orthoMCL 1 0.900 - - OOG6_101819
Panther 1 1.100 - - LDO PTHR10442
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1875
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.