Sequence 1: | NP_001259970.1 | Gene: | RpS21 / 33487 | FlyBaseID: | FBgn0015521 | Length: | 83 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024307727.1 | Gene: | RPS21 / 6227 | HGNCID: | 10409 | Length: | 359 | Species: | Homo sapiens |
Alignment Length: | 62 | Identity: | 45/62 - (72%) |
---|---|---|---|
Similarity: | 51/62 - (82%) | Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSKTYAICGEIRRM 62 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpS21 | NP_001259970.1 | Ribosomal_S21e | 1..77 | CDD:279574 | 45/62 (73%) |
RPS21 | XP_024307727.1 | Ribosomal_S21e | 270..>331 | CDD:307419 | 43/60 (72%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156765 | |
Domainoid | 1 | 1.000 | 119 | 1.000 | Domainoid score | I5831 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3486 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H90915 | |
Inparanoid | 1 | 1.050 | 126 | 1.000 | Inparanoid score | I4706 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54242 | |
OrthoDB | 1 | 1.010 | - | - | D1571849at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002785 | |
OrthoInspector | 1 | 1.000 | - | - | oto89175 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_101819 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR10442 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1237 |
SonicParanoid | 1 | 1.000 | - | - | X1875 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
15 | 14.840 |