DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS21 and rps21

DIOPT Version :9

Sequence 1:NP_001259970.1 Gene:RpS21 / 33487 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_595852.1 Gene:rps21 / 2540806 PomBaseID:SPBC18E5.06 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:80 Identity:53/80 - (66%)
Similarity:63/80 - (78%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSK-TYAICGEIRRMGE 64
            |||:||:.|||||||||||:||||.||||||||:::..||.| |||..|.| ||||.|.:|..||
pombe     1 MENEAGQLVDLYVPRKCSATNRIIQAKDHASVQINVCAVDAE-GRQIPGEKTTYAISGFVRSKGE 64

  Fly    65 SDDCIVRLAKKDGII 79
            |||||.||..:||::
pombe    65 SDDCINRLTTQDGLL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS21NP_001259970.1 Ribosomal_S21e 1..77 CDD:279574 51/76 (67%)
rps21NP_595852.1 Ribosomal_S21e 1..77 CDD:279574 51/76 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I1777
eggNOG 1 0.900 - - E1_KOG3486
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90915
Inparanoid 1 1.050 102 1.000 Inparanoid score I1649
OMA 1 1.010 - - QHG54242
OrthoFinder 1 1.000 - - FOG0002785
OrthoInspector 1 1.000 - - oto100849
orthoMCL 1 0.900 - - OOG6_101819
Panther 1 1.100 - - LDO PTHR10442
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1237
SonicParanoid 1 1.000 - - X1875
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.