DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and MBP1

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_010227.1 Gene:MBP1 / 851503 SGDID:S000002214 Length:833 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:53/223 - (23%)
Similarity:89/223 - (39%) Gaps:55/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRE 127
            :|...||...     |...:|...|:|.:.:.|.:||.|:.:.::.|.|||           :|.
Yeast   387 IDAPIDPELH-----TAFHWACSMGNLPIAEALYEAGTSIRSTNSQGQTPL-----------MRS 435

  Fly   128 LLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEID--IKRIDGATPLWIAAQMGQDHI 190
            .|    ..|::.:.....:|   |..|.||..:..|:...|.  :|| ...||..:       :.
Yeast   436 SL----FHNSYTRRTFPRIF---QLLHETVFDIDSQSQTVIHHIVKR-KSTTPSAV-------YY 485

  Fly   191 CKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLPNGESALHAAAMFGHMTV 255
            ..|:|.        :....:|.::         |.:||.     .|..||::|||.|:..|.:..
Yeast   486 LDVVLS--------KIKDFSPQYR---------IELLLN-----TQDKNGDTALHIASKNGDVVF 528

  Fly   256 CKQLVAAGSDVLLKNHDGLTALQLAHQQ 283
            ...||..|:...:.|.:||||.::.:||
Yeast   529 FNTLVKMGALTTISNKEGLTANEIMNQQ 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 3/8 (38%)
ANK repeat 13..40 CDD:293786
ANK 37..162 CDD:238125 23/98 (23%)
ANK repeat 42..73 CDD:293786 3/9 (33%)
Ank_2 47..137 CDD:289560 17/73 (23%)
ANK repeat 75..106 CDD:293786 8/30 (27%)
ANK 103..228 CDD:238125 22/126 (17%)
ANK repeat 108..137 CDD:293786 6/28 (21%)
Ank_2 113..202 CDD:289560 17/90 (19%)
ANK repeat 141..171 CDD:293786 7/31 (23%)
ANK 169..292 CDD:238125 28/117 (24%)
ANK repeat 174..204 CDD:293786 4/29 (14%)
Ank_2 179..270 CDD:289560 17/90 (19%)
ANK repeat 207..237 CDD:293786 4/29 (14%)
ANK repeat 239..270 CDD:293786 10/30 (33%)
MBP1NP_010227.1 KilA-N 22..93 CDD:367917
ANKYR 363..544 CDD:223738 46/209 (22%)
ANK repeat 396..425 CDD:293786 8/33 (24%)
ANK repeat 427..510 CDD:293786 24/130 (18%)
ANK repeat 512..543 CDD:293786 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.