| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001189808.1 | Gene: | TPR10 / 819629 | AraportID: | AT3G04710 | Length: | 680 | Species: | Arabidopsis thaliana |
| Alignment Length: | 246 | Identity: | 87/246 - (35%) |
|---|---|---|---|
| Similarity: | 122/246 - (49%) | Gaps: | 6/246 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 LHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGT 77
Fly 78 TPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDR 142
Fly 143 ATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCD 207
Fly 208 GATPLFKAAHKGHAAVITVLLKYRPNLGQLPNGESALHAAAMFGHMTVCKQ 258 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 27/58 (47%) |
| ANK repeat | 13..40 | CDD:293786 | 8/26 (31%) | ||
| ANK | 37..162 | CDD:238125 | 50/124 (40%) | ||
| ANK repeat | 42..73 | CDD:293786 | 16/30 (53%) | ||
| Ank_2 | 47..137 | CDD:289560 | 35/89 (39%) | ||
| ANK repeat | 75..106 | CDD:293786 | 11/30 (37%) | ||
| ANK | 103..228 | CDD:238125 | 43/124 (35%) | ||
| ANK repeat | 108..137 | CDD:293786 | 10/28 (36%) | ||
| Ank_2 | 113..202 | CDD:289560 | 32/88 (36%) | ||
| ANK repeat | 141..171 | CDD:293786 | 10/29 (34%) | ||
| ANK | 169..292 | CDD:238125 | 26/90 (29%) | ||
| ANK repeat | 174..204 | CDD:293786 | 13/29 (45%) | ||
| Ank_2 | 179..270 | CDD:289560 | 22/80 (28%) | ||
| ANK repeat | 207..237 | CDD:293786 | 8/29 (28%) | ||
| ANK repeat | 239..270 | CDD:293786 | 4/20 (20%) | ||
| TPR10 | NP_001189808.1 | DUF1685 | 82..>125 | CDD:285215 | |
| Alpha_adaptinC2 | <202..264 | CDD:296022 | |||
| Ank_2 | 245..341 | CDD:289560 | 26/57 (46%) | ||
| ANK | <245..299 | CDD:295348 | 5/15 (33%) | ||
| ANK repeat | 282..310 | CDD:293786 | 8/26 (31%) | ||
| ANK | 307..431 | CDD:238125 | 50/124 (40%) | ||
| ANK repeat | 313..343 | CDD:293786 | 16/29 (55%) | ||
| Ank_2 | 317..407 | CDD:289560 | 36/90 (40%) | ||
| ANK repeat | 345..376 | CDD:293786 | 11/30 (37%) | ||
| ANK repeat | 378..407 | CDD:293786 | 11/28 (39%) | ||
| ANK | 380..495 | CDD:238125 | 40/115 (35%) | ||
| Ank_2 | 382..473 | CDD:289560 | 32/91 (35%) | ||
| ANK repeat | 410..441 | CDD:293786 | 10/31 (32%) | ||
| ANK repeat | 442..473 | CDD:293786 | 13/30 (43%) | ||
| TPR repeat | 585..615 | CDD:276809 | |||
| TPR repeat | 620..645 | CDD:276809 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53592 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm2422 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||