| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005270242.2 | Gene: | TNKS2 / 80351 | HGNCID: | 15677 | Length: | 1190 | Species: | Homo sapiens |
| Alignment Length: | 324 | Identity: | 95/324 - (29%) |
|---|---|---|---|
| Similarity: | 151/324 - (46%) | Gaps: | 51/324 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 QLHMAAMRGDEVALLRVLDSGKVHVDCKDEDG--TTPLILAAAGGHTYCVMELLDQGADPNSRRL 74
Fly 75 TGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGAN---VN 136
Fly 137 AH------------MKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRI---------------D 174
Fly 175 GATPLWIAAQM---GQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQ 236
Fly 237 LPN-GESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERIRTM 299 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 21/60 (35%) |
| ANK repeat | 13..40 | CDD:293786 | 7/26 (27%) | ||
| ANK | 37..162 | CDD:238125 | 42/141 (30%) | ||
| ANK repeat | 42..73 | CDD:293786 | 14/32 (44%) | ||
| Ank_2 | 47..137 | CDD:289560 | 30/92 (33%) | ||
| ANK repeat | 75..106 | CDD:293786 | 11/30 (37%) | ||
| ANK | 103..228 | CDD:238125 | 42/157 (27%) | ||
| ANK repeat | 108..137 | CDD:293786 | 9/31 (29%) | ||
| Ank_2 | 113..202 | CDD:289560 | 32/121 (26%) | ||
| ANK repeat | 141..171 | CDD:293786 | 9/29 (31%) | ||
| ANK | 169..292 | CDD:238125 | 41/141 (29%) | ||
| ANK repeat | 174..204 | CDD:293786 | 11/32 (34%) | ||
| Ank_2 | 179..270 | CDD:289560 | 32/94 (34%) | ||
| ANK repeat | 207..237 | CDD:293786 | 9/29 (31%) | ||
| ANK repeat | 239..270 | CDD:293786 | 12/31 (39%) | ||
| TNKS2 | XP_005270242.2 | Ank_2 | 28..142 | CDD:372319 | |
| ANK repeat | 60..109 | CDD:293786 | |||
| PHA02876 | <94..>479 | CDD:165207 | 87/288 (30%) | ||
| ANK repeat | 111..142 | CDD:293786 | |||
| ANK repeat | 144..175 | CDD:293786 | |||
| ANK repeat | 234..262 | CDD:293786 | 12/27 (44%) | ||
| ANK repeat | 264..295 | CDD:293786 | 11/30 (37%) | ||
| ANK repeat | 297..328 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 386..418 | CDD:293786 | 11/31 (35%) | ||
| ANK repeat | 420..451 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 453..482 | CDD:293786 | 11/28 (39%) | ||
| PHA03095 | 540..>826 | CDD:222980 | |||
| ANK repeat | 552..580 | CDD:293786 | |||
| ANK repeat | 582..613 | CDD:293786 | |||
| ANK repeat | 615..646 | CDD:293786 | |||
| ANK repeat | 668..698 | CDD:293786 | |||
| ANK repeat | 705..733 | CDD:293786 | |||
| ANK repeat | 735..766 | CDD:293786 | |||
| ANK repeat | 768..799 | CDD:293786 | |||
| SAM_tankyrase1,2 | 895..960 | CDD:188923 | |||
| tankyrase_like | 962..1184 | CDD:238718 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||